CXCR2 Antikörper (N-Term)

Produktnummer ABIN634514

Der Kaninchen Polyklonal anti-CXCR2 Antikörper wird verwendet zum Nachweis von CXCR2 in Proben von Human. Er wurde validiert für WB.

Kurzübersicht für CXCR2 Antikörper (N-Term) (ABIN634514)

Target: CXCR2 (Chemokine (C-X-C Motif) Receptor 2 (CXCR2))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CXCR2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-CXCR2 Antikörper

Bindungsspezifität: N-Term

Spezifität: IL8 RB antibody was raised against the N terminal of IL8 B

Aufreinigung: Affinity purified

Immunogen: IL8 RB antibody was raised using the N terminal of IL8 B corresponding to a region with amino acids MEDFNMESDSFEDFWKGEDLSNYSYSSTLPPFLLDAAPCEPESLEINKYF

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

IL8RB Blocking Peptide, (ABIN5614178), is also available for use as a blocking control in assays to test for specificity of this IL8RB antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IL0 B antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CXCR2

Target: CXCR2 (Chemokine (C-X-C Motif) Receptor 2 (CXCR2))

Andere Bezeichnung: IL8RB

Hintergrund: IL8RB is the receptor for interleukin-8 which is a powerful neutrophil chemotactic factor. Binding of IL-8 to the receptor causes activation of neutrophils. This response is mediated via a G-protein that activates a phosphatidylinositol-calcium second messenger system. IL8RB binds to IL-8 with high affinity. IL8RB also binds with high affinity to CXCL3, GRO/MGSA and NAP-2.

Molekulargewicht: 41 kDa (MW of target protein)

Pathways: cAMP Metabolic Process