LGALS1/Galectin 1 Antikörper

Produktnummer ABIN634507

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch LGALS1/Galectin 1 in WB. Es zeigt Reaktivität gegenüber Proben von Human.

Kurzübersicht für LGALS1/Galectin 1 Antikörper (ABIN634507)

Target: LGALS1/Galectin 1 (LGALS1) (Lectin, Galactoside-Binding, Soluble, 1 (LGALS1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser LGALS1/Galectin 1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-LGALS1/Galectin 1 Antikörper

Aufreinigung: Affinity purified

Immunogen: LGALS1 antibody was raised using a synthetic peptide corresponding to a region with amino acids EQREAVFPFQPGSVAEVCITFDQANLTVKLPDGYEFKFPNRLNLEAINYM

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

LGALS1 Blocking Peptide, (ABIN938062), is also available for use as a blocking control in assays to test for specificity of this LGALS1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LGALS1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu LGALS1/Galectin 1

Target: LGALS1/Galectin 1 (LGALS1) (Lectin, Galactoside-Binding, Soluble, 1 (LGALS1))

Andere Bezeichnung: LGALS1

Hintergrund: The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. LGALS1 may act as an autocrine negative growth factor that regulates cell proliferation.

Molekulargewicht: 15 kDa (MW of target protein)

Pathways: Carbohydrate Homeostasis