TRAF7 Antikörper (N-Term)

Produktnummer ABIN634504

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch TRAF7 in WB. Er zeigt eine Reaktivität gegenüber Human und Ratte.

Kurzübersicht für TRAF7 Antikörper (N-Term) (ABIN634504)

Target: TRAF7 (TNF Receptor-Associated Factor 7 (TRAF7))

Reaktivität: Human, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TRAF7 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-TRAF7 Antikörper

Bindungsspezifität: N-Term

Spezifität: TRAF7 antibody was raised against the N terminal of TRAF7

Aufreinigung: Affinity purified

Immunogen: TRAF7 antibody was raised using the N terminal of TRAF7 corresponding to a region with amino acids GPAFSAVTTITKADGTSTYKQHCRTPSSSSTLAYSPRDEEDSMPPISTPR

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TRAF7 Blocking Peptide, (ABIN938848), is also available for use as a blocking control in assays to test for specificity of this TRAF7 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRAF7 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TRAF7

Target: TRAF7 (TNF Receptor-Associated Factor 7 (TRAF7))

Andere Bezeichnung: TRAF7

Hintergrund: Tumor necrosis factor (TNF) receptor-associated factors, such as TRAF7, are signal transducers for members of the TNF receptor superfamily.

Molekulargewicht: 74 kDa (MW of target protein)