VPREB1 Antikörper (Middle Region)

Produktnummer ABIN634478

Produktdetails anti-VPREB1 Antikörper

Target: VPREB1 (Pre-B Lymphocyte 1 (VPREB1))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser VPREB1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: VPREB1 antibody was raised against the middle region of VPREB1

Aufreinigung: Affinity purified

Immunogen: VPREB1 antibody was raised using the middle region of VPREB1 corresponding to a region with amino acids TIRLTCTLRNDHDIGVYSVYWYQQRPGHPPRFLLRYFSQSDKSQGPQVPP

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

VPREB1 Blocking Peptide, catalog no. 33R-9127, is also available for use as a blocking control in assays to test for specificity of this VPREB1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of VPREB1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu VPREB1

Target: VPREB1 (Pre-B Lymphocyte 1 (VPREB1))

Andere Bezeichnung: VPREB1 (VPREB1 Produkte)

Synonyme: IGI antikoerper, IGVPB antikoerper, VPREB antikoerper, VpreB antikoerper, CD179a antikoerper, Vpreb-1 antikoerper, V-set pre-B cell surrogate light chain 1 antikoerper, immunoglobulin iota chain antikoerper, immunoglobulin iota chain-like antikoerper, pre-B lymphocyte 1 antikoerper, pre-B lymphocyte gene 1 antikoerper, VPREB1 antikoerper, LOC698810 antikoerper, LOC486411 antikoerper, Vpreb1 antikoerper

Hintergrund: VPREB1 belongs to the immunoglobulin superfamily and is expressed selectively at the early stages of B cell development, namely, in proB and early preB cells.

Molekulargewicht: 16 kDa (MW of target protein)

Pathways: Production of Molecular Mediator of Immune Response, Regulation of Cell Size