VPREB1 Antikörper (Middle Region)
-
- Target Alle VPREB1 Antikörper anzeigen
- VPREB1 (Pre-B Lymphocyte 1 (VPREB1))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser VPREB1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- VPREB1 antibody was raised against the middle region of VPREB1
- Aufreinigung
- Affinity purified
- Immunogen
- VPREB1 antibody was raised using the middle region of VPREB1 corresponding to a region with amino acids TIRLTCTLRNDHDIGVYSVYWYQQRPGHPPRFLLRYFSQSDKSQGPQVPP
- Top Product
- Discover our top product VPREB1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
VPREB1 Blocking Peptide, catalog no. 33R-9127, is also available for use as a blocking control in assays to test for specificity of this VPREB1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of VPREB1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- VPREB1 (Pre-B Lymphocyte 1 (VPREB1))
- Andere Bezeichnung
- VPREB1 (VPREB1 Produkte)
- Hintergrund
- VPREB1 belongs to the immunoglobulin superfamily and is expressed selectively at the early stages of B cell development, namely, in proB and early preB cells.
- Molekulargewicht
- 16 kDa (MW of target protein)
- Pathways
- Production of Molecular Mediator of Immune Response, Regulation of Cell Size
-