SDCBP2 Antikörper

Produktnummer ABIN634476

Der Kaninchen Polyklonal anti-SDCBP2 Antikörper (ABIN634476) detektiert spezifisch SDCBP2 in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human.

Kurzübersicht für SDCBP2 Antikörper (ABIN634476)

Target: SDCBP2 (Syndecan Binding Protein (Syntenin) 2 (SDCBP2))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SDCBP2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-SDCBP2 Antikörper

Aufreinigung: Affinity purified

Immunogen: SDCBP2 antibody was raised using a synthetic peptide corresponding to a region with amino acids VAPVTGYSLGVRRAEIKPGVREIHLCKDERGKTGLRLRKVDQGLFVQLVQ

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SDCBP2 Blocking Peptide, (ABIN5616023), is also available for use as a blocking control in assays to test for specificity of this SDCBP2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SDCBP2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SDCBP2

Target: SDCBP2 (Syndecan Binding Protein (Syntenin) 2 (SDCBP2))

Andere Bezeichnung: SDCBP2

Hintergrund: SDCBP2 contains 2 PDZ (DHR) domains. The function of SDCBP2 remains unknown.

Molekulargewicht: 23 kDa (MW of target protein)