RBM9 Antikörper (Middle Region)

Produktnummer ABIN634463

Der Kaninchen-Polyklonal Anti-RBM9-Antikörper wurde für WB validiert. Er ist geeignet zum Nachweis von RBM9 in Proben aus Human. }

Kurzübersicht für RBM9 Antikörper (Middle Region) (ABIN634463)

Target: RBM9 (RNA Binding Motif Protein 9 (RBM9))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RBM9 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-RBM9 Antikörper

Bindungsspezifität: Middle Region

Spezifität: RBM9 antibody was raised against the middle region of RBM9

Aufreinigung: Affinity purified

Immunogen: RBM9 antibody was raised using the middle region of RBM9 corresponding to a region with amino acids PPTAIPAYPGVDMQPTDMHSLLLQPQPPLLQPLQPLTVTVMAGCTQPTPT

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RBM9 Blocking Peptide, (ABIN5615798), is also available for use as a blocking control in assays to test for specificity of this RBM9 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RBM9 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RBM9

Target: RBM9 (RNA Binding Motif Protein 9 (RBM9))

Andere Bezeichnung: RBM9

Hintergrund: RBM9 is a RNA-binding protein that seems to act as a coregulatory factor of ER-alpha.

Molekulargewicht: 39 kDa (MW of target protein)

Pathways: Intracellular Steroid Hormone Receptor Signaling Pathway, Skeletal Muscle Fiber Development