APOBEC3G Antikörper (N-Term)

Produktnummer ABIN634462

Produktdetails anti-APOBEC3G Antikörper

Target: APOBEC3G (Apolipoprotein B mRNA Editing Enzyme, Catalytic Polypeptide-Like 3G (APOBEC3G))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser APOBEC3G Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: ApoBEC3 G antibody was raised against the N terminal of APOBEC3

Aufreinigung: Affinity purified

Immunogen: ApoBEC3 G antibody was raised using the N terminal of APOBEC3 corresponding to a region with amino acids AKIFRGQVYSELKYHPEMRFFHWFSKWRKLHRDQEYEVTWYISWSPCTKC

Anwendungsinformationen

Applikationshinweise: WB: 2 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of APOBEC0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu APOBEC3G

Target: APOBEC3G (Apolipoprotein B mRNA Editing Enzyme, Catalytic Polypeptide-Like 3G (APOBEC3G))

Andere Bezeichnung: ApoBEC3G (APOBEC3G Produkte)

Synonyme: A3G antikoerper, ARCD antikoerper, ARP-9 antikoerper, ARP9 antikoerper, CEM-15 antikoerper, CEM15 antikoerper, bK150C2.7 antikoerper, dJ494G10.1 antikoerper, apolipoprotein B mRNA editing enzyme catalytic subunit 3G antikoerper, APOBEC3G antikoerper

Hintergrund: APOBEC3G is a member of the cytidine deaminase gene family. It is one of seven related genes or pseudogenes found in a cluster, thought to result from gene duplication, on chromosome 22. Members of the cluster encode proteins that are structurally and functionally related to the C to U RNA-editing cytidine deaminase APOBEC1. It is thought that the proteins may be RNA editing enzymes and have roles in growth or cell cycle control.

Molekulargewicht: 46 kDa (MW of target protein)