OAS1 Antikörper (N-Term)

Produktnummer ABIN634460

Der Kaninchen Polyklonal Anti-OAS1-Antikörper wurde für WB validiert. Er ist geeignet, OAS1 in Proben von Human zu detektieren.

Kurzübersicht für OAS1 Antikörper (N-Term) (ABIN634460)

Target: OAS1 (2',5'-Oligoadenylate Synthetase 1, 40/46kDa (OAS1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser OAS1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-OAS1 Antikörper

Bindungsspezifität: N-Term

Spezifität: OAS1 antibody was raised against the N terminal of OAS1

Aufreinigung: Affinity purified

Immunogen: OAS1 antibody was raised using the N terminal of OAS1 corresponding to a region with amino acids MMDLRNTPAKSLDKFIEDYLLPDTCFRMQINHAIDIICGFLKERCFRGSS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

OAS1 Blocking Peptide, (ABIN5615097), is also available for use as a blocking control in assays to test for specificity of this OAS1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OAS1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu OAS1

Target: OAS1 (2',5'-Oligoadenylate Synthetase 1, 40/46kDa (OAS1))

Andere Bezeichnung: OAS1

Hintergrund: This protein is a member of the 2-5A synthetase family, essential proteins involved in the innate immune response to viral infection.

Molekulargewicht: 42 kDa (MW of target protein)

Pathways: Hepatitis C