ASB6 Antikörper (Middle Region)

Produktnummer ABIN634452

Dieser Anti-ASB6-Antikörper ist ein Kaninchen-Polyklonal-Antikörper zum Nachweis von ASB6 in WB. Geeignet für Human, Maus und Ratte.

Kurzübersicht für ASB6 Antikörper (Middle Region) (ABIN634452)

Target: ASB6 (Ankyrin Repeat and SOCS Box Containing 6 (ASB6))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ASB6 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-ASB6 Antikörper

Bindungsspezifität: Middle Region

Spezifität: ASB6 antibody was raised against the middle region of ASB6

Aufreinigung: Affinity purified

Immunogen: ASB6 antibody was raised using the middle region of ASB6 corresponding to a region with amino acids LKMAELGLTRAADVLLRHGANLNFEDPVTYYTALHIAVLRNQPDMVELLV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ASB6 Blocking Peptide, (ABIN940476), is also available for use as a blocking control in assays to test for specificity of this ASB6 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ASB6 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ASB6

Target: ASB6 (Ankyrin Repeat and SOCS Box Containing 6 (ASB6))

Andere Bezeichnung: ASB6

Hintergrund: ASB6 belongs to a family of ankyrin repeat proteins that, along with four other protein families, contain a C-terminal SOCS box motif. Growing evidence suggests that the SOCS box, similar to the F-box, acts as a bridge between specific substrate-binding domains and the more generic proteins that comprise a large family of E3 ubiquitin protein ligases.

Molekulargewicht: 46 kDa (MW of target protein)