Adenylate Kinase 3 Antikörper (N-Term)
-
- Target Alle Adenylate Kinase 3 (AK3) Antikörper anzeigen
- Adenylate Kinase 3 (AK3)
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Adenylate Kinase 3 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- AK3 antibody was raised against the N terminal of AK3
- Aufreinigung
- Affinity purified
- Immunogen
- AK3 antibody was raised using the N terminal of AK3 corresponding to a region with amino acids MGASARLLRAVIMGAPGSGKGTVSSRITTHFELKHLSSGDLLRDNMLRGT
- Top Product
- Discover our top product AK3 Primärantikörper
-
anti-Adenylate Kinase 3 (AK3) (AA 8-227) antibody
AK3 Reaktivität: Human WB, IHC, IP, ICC Wirt: Kaninchen Polyclonal unconjugated
anti-Adenylate Kinase 3 (AK3) (AA 1-227) antibodyAK3 Reaktivität: Human WB Wirt: Maus Polyclonal unconjugated
anti-Adenylate Kinase 3 (AK3) (AA 25-86) antibodyAK3 Reaktivität: Human WB, ELISA Wirt: Maus Monoclonal 1D2 unconjugated
anti-Adenylate Kinase 3 (AK3) (AA 195-223), (C-Term) antibodyAK3 Reaktivität: Human, Maus WB, IHC (p) Wirt: Kaninchen Polyclonal RB3888 unconjugated
anti-Adenylate Kinase 3 (AK3) (AA 1-227) antibodyAK3 Reaktivität: Human WB, IP Wirt: Kaninchen Polyclonal unconjugated
anti-Adenylate Kinase 3 (AK3) antibodyAK3 Reaktivität: Human, Maus WB, ELISA, IHC Wirt: Maus Monoclonal SJB3-36 unconjugated
anti-Adenylate Kinase 3 (AK3) antibodyAK3 Reaktivität: Human, Ratte, Hund, Affe WB Wirt: Maus Monoclonal 6D6 unconjugated
anti-Adenylate Kinase 3 (AK3) antibodyAK3 Reaktivität: Human, Ratte, Hund, Affe WB Wirt: Maus Monoclonal 6B7 unconjugated
anti-Adenylate Kinase 3 (AK3) (AA 142-227) antibodyAK3 Reaktivität: Human ELISA, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Adenylate Kinase 3 (AK3) (AA 23-53), (N-Term) antibodyAK3 Reaktivität: Human WB Wirt: Kaninchen Polyclonal RB5365 unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
AK3 Blocking Peptide, catalog no. 33R-6011, is also available for use as a blocking control in assays to test for specificity of this AK3 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AK3 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Adenylate Kinase 3 (AK3)
- Andere Bezeichnung
- AK3 (AK3 Produkte)
- Synonyme
- AK3L1 antikoerper, AK6 antikoerper, AKL3L antikoerper, AKL3L1 antikoerper, FIX antikoerper, AK4 antikoerper, AA407498 antikoerper, AI506714 antikoerper, AK-3 antikoerper, Ak3l antikoerper, Ak3l1 antikoerper, Akl3l antikoerper, ak3l1 antikoerper, sb:cb845 antikoerper, zgc:64135 antikoerper, id:ibd3034 antikoerper, wu:fa02c11 antikoerper, wu:fc20h08 antikoerper, AK3 antikoerper, CG6612 antikoerper, DAK3 antikoerper, Dak3 antikoerper, Dmel\\CG6612 antikoerper, bs12h03.y1 antikoerper, MGC114646 antikoerper, ak6 antikoerper, adenylate kinase 3 antikoerper, Adenylate kinase 3 antikoerper, adenylate kinase 3 L homeolog antikoerper, AK3 antikoerper, Ak3 antikoerper, ak3 antikoerper, Adk3 antikoerper, ak3.L antikoerper, ADK3 antikoerper
- Hintergrund
- The AK3 protein is a GTP:ATP phosphotransferase that is found in the mitochondrial matrix. Several transcript variants encoding a few different isoforms have been found for this gene.
- Molekulargewicht
- 25 kDa (MW of target protein)
- Pathways
- Nucleotide Phosphorylation, Ribonucleoside Biosynthetic Process
-
