Adenylate Kinase 3 Antikörper (N-Term)

Produktnummer ABIN634447

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch Adenylate Kinase 3 in WB. Er zeigt eine Reaktivität gegenüber Human, Maus und Ratte.

Kurzübersicht für Adenylate Kinase 3 Antikörper (N-Term) (ABIN634447)

Target: Adenylate Kinase 3 (AK3)

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Adenylate Kinase 3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-Adenylate Kinase 3 Antikörper

Bindungsspezifität: N-Term

Spezifität: AK3 antibody was raised against the N terminal of AK3

Aufreinigung: Affinity purified

Immunogen: AK3 antibody was raised using the N terminal of AK3 corresponding to a region with amino acids MGASARLLRAVIMGAPGSGKGTVSSRITTHFELKHLSSGDLLRDNMLRGT

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

AK3 Blocking Peptide, catalog no. 33R-6011, is also available for use as a blocking control in assays to test for specificity of this AK3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AK3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Adenylate Kinase 3

Target: Adenylate Kinase 3 (AK3)

Andere Bezeichnung: AK3

Hintergrund: The AK3 protein is a GTP:ATP phosphotransferase that is found in the mitochondrial matrix. Several transcript variants encoding a few different isoforms have been found for this gene.

Molekulargewicht: 25 kDa (MW of target protein)

Pathways: Nucleotide Phosphorylation, Ribonucleoside Biosynthetic Process