TBL3 Antikörper

Produktnummer ABIN634442

Produktdetails anti-TBL3 Antikörper

Target: TBL3 (Transducin (Beta)-Like 3 (TBL3))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TBL3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: TBL3 antibody was raised using a synthetic peptide corresponding to a region with amino acids MAETAAGVGRFKTNYAVERKIEPFYKGGKAQLDQTGQHLFCVCGTRVNIL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TBL3 Blocking Peptide, catalog no. 33R-5646, is also available for use as a blocking control in assays to test for specificity of this TBL3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TBL3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TBL3

Target: TBL3 (Transducin (Beta)-Like 3 (TBL3))

Andere Bezeichnung: TBL3 (TBL3 Produkte)

Synonyme: MGC69179 antikoerper, zgc:101778 antikoerper, AmCG7589 antikoerper, GB11903 antikoerper, SAZD antikoerper, UTP13 antikoerper, 9430070M15Rik antikoerper, transducin (beta)-like 3 L homeolog antikoerper, transducin beta like 3 antikoerper, transducin (beta)-like 3 antikoerper, transducin beta-like protein 3 antikoerper, tbl3.L antikoerper, TBL3 antikoerper, tbl3 antikoerper, LOC724596 antikoerper, Tbl3 antikoerper

Hintergrund: The protein encoded by this gene has sequence similarity with members of the WD40 repeat-containing protein family. The WD40 group is a large family of proteins, which appear to have a regulatory function.

Molekulargewicht: 89 kDa (MW of target protein)