TBL3 Antikörper

Produktnummer ABIN634442

Der Kaninchen Polyklonal anti-TBL3 Antikörper wird verwendet zum Nachweis von TBL3 in Proben von Human. Er wurde validiert für WB.

Kurzübersicht für TBL3 Antikörper (ABIN634442)

Target: TBL3 (Transducin (Beta)-Like 3 (TBL3))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TBL3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-TBL3 Antikörper

Aufreinigung: Affinity purified

Immunogen: TBL3 antibody was raised using a synthetic peptide corresponding to a region with amino acids MAETAAGVGRFKTNYAVERKIEPFYKGGKAQLDQTGQHLFCVCGTRVNIL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TBL3 Blocking Peptide, (ABIN5616523), is also available for use as a blocking control in assays to test for specificity of this TBL3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TBL3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TBL3

Target: TBL3 (Transducin (Beta)-Like 3 (TBL3))

Andere Bezeichnung: TBL3

Hintergrund: The protein encoded by this gene has sequence similarity with members of the WD40 repeat-containing protein family. The WD40 group is a large family of proteins, which appear to have a regulatory function.

Molekulargewicht: 89 kDa (MW of target protein)