RAB38 Antikörper (N-Term)

Produktnummer ABIN634438

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch RAB38 in WB. Er zeigt eine Reaktivität gegenüber Human, Maus und Ratte.

Kurzübersicht für RAB38 Antikörper (N-Term) (ABIN634438)

Target: RAB38 (RAB38, Member RAS Oncogene Family (RAB38))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RAB38 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-RAB38 Antikörper

Bindungsspezifität: N-Term

Spezifität: RAB38 antibody was raised against the N terminal of RAB38

Aufreinigung: Affinity purified

Immunogen: RAB38 antibody was raised using the N terminal of RAB38 corresponding to a region with amino acids MQAPHKEHLYKLLVIGDLGVGKTSIIKRYVHQNFSSHYRATIGVDFALKV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RAB38 Blocking Peptide, (ABIN5615707), is also available for use as a blocking control in assays to test for specificity of this RAB38 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAB38 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RAB38

Target: RAB38 (RAB38, Member RAS Oncogene Family (RAB38))

Andere Bezeichnung: RAB38

Hintergrund: RAB38 may be involved in melanosomal transport and docking. Involved in the proper sorting of TYRP1.

Molekulargewicht: 24 kDa (MW of target protein)