Calcyphosine Antikörper (N-Term)

Produktnummer ABIN634437

Dieses Anti-Calcyphosine-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von Calcyphosine in WB. Geeignet für Human.

Kurzübersicht für Calcyphosine Antikörper (N-Term) (ABIN634437)

Target: Calcyphosine (CAPS)

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Calcyphosine Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-Calcyphosine Antikörper

Bindungsspezifität: N-Term

Spezifität: CAPS antibody was raised against the N terminal of CAPS

Aufreinigung: Affinity purified

Immunogen: CAPS antibody was raised using the N terminal of CAPS corresponding to a region with amino acids DAVDATMEKLRAQCLSRGASGIQGLARFFRQLDRDGSRSLDADEFRQGLA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CAPS Blocking Peptide, (ABIN937250), is also available for use as a blocking control in assays to test for specificity of this CAPS antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CAPS antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Calcyphosine

Target: Calcyphosine (CAPS)

Andere Bezeichnung: CAPS

Hintergrund: CAPS is a calcium-binding protein, which may play a role in the regulation of ion transport. A similar protein was first described as a potentially important regulatory protein in the dog thyroid and was termed as R2D5 antigen in rabbit.

Molekulargewicht: 21 kDa (MW of target protein)