ADA Antikörper (N-Term)

Produktnummer ABIN634435

Produktdetails anti-ADA Antikörper

Target: ADA (Adenosine Deaminase (ADA))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ADA Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: ADA antibody was raised against the N terminal of ADA

Aufreinigung: Affinity purified

Immunogen: ADA antibody was raised using the N terminal of ADA corresponding to a region with amino acids AIAGCREAIKRIAYEFVEMKAKEGVVYVEVRYSPHLLANSKVEPIPWNQA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ADA Blocking Peptide, catalog no. 33R-1257, is also available for use as a blocking control in assays to test for specificity of this ADA antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ADA antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ADA

Target: ADA (Adenosine Deaminase (ADA))

Andere Bezeichnung: ADA (ADA Produkte)

Synonyme: ADA-like antikoerper, xada antikoerper, ADA antikoerper, CG11994 antikoerper, Dmel\\CG11994 antikoerper, DrosADA antikoerper, dADA antikoerper, zgc:92028 antikoerper, adenosine deaminase antikoerper, adenosine deaminase S homeolog antikoerper, Adenosine deaminase antikoerper, ADA antikoerper, Ada antikoerper, ada.S antikoerper, ada antikoerper

Hintergrund: ADA is an enzyme that catalyzes the hydrolysis of adenosine to inosine. Various mutations have been described for this gene and have been linked to human diseases. Deficiency in this enzyme causes a form of severe combined immunodeficiency disease (SCID), in which there is dysfunction of both B and T lymphocytes with impaired cellular immunity and decreased production of immunoglobulins, whereas elevated levels of this enzyme have been associated with congenital hemolytic anemia.

Molekulargewicht: 41 kDa (MW of target protein)

Pathways: Regulation of G-Protein Coupled Receptor Protein Signaling, Ribonucleoside Biosynthetic Process