RAB40B Antikörper (Middle Region)

Produktnummer ABIN634429

Produktdetails anti-RAB40B Antikörper

Target: RAB40B (RAB40B, Member RAS Oncogene Family (RAB40B))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RAB40B Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: RAB40 B antibody was raised against the middle region of RAB40

Aufreinigung: Affinity purified

Immunogen: RAB40 B antibody was raised using the middle region of RAB40 corresponding to a region with amino acids YAERLGVTFFEVSPLCNFNITESFTELARIVLLRHGMDRLWRPSKVLSLQ

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RAB40B Blocking Peptide, catalog no. 33R-10045, is also available for use as a blocking control in assays to test for specificity of this RAB40B antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAB40 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RAB40B

Target: RAB40B (RAB40B, Member RAS Oncogene Family (RAB40B))

Andere Bezeichnung: RAB40B (RAB40B Produkte)

Synonyme: rab40 antikoerper, rar antikoerper, sec4l antikoerper, xrab40 antikoerper, zgc:92926 antikoerper, MGC145203 antikoerper, RAR antikoerper, SEC4L antikoerper, RAB40B antikoerper, RAB40B, member RAS oncogene family L homeolog antikoerper, RAB40B, member RAS oncogene family antikoerper, Rab40B, member RAS oncogene family antikoerper, Rab40b, member RAS oncogene family antikoerper, rab40b.L antikoerper, rab40b antikoerper, RAB40B antikoerper, Rab40b antikoerper

Hintergrund: RAB40B has similarity to a yeast protein which suggests a role of the gene product in regulating secretory vesicles.

Molekulargewicht: 31 kDa (MW of target protein)