RAB40B Antikörper (Middle Region)

Produktnummer ABIN634429

Dieser Kaninchen Polyklonal Antikörper erkennt spezifisch RAB40B in WB. Er zeigt eine Reaktivität gegenüber Human, Maus und Ratte.

Kurzübersicht für RAB40B Antikörper (Middle Region) (ABIN634429)

Target: RAB40B (RAB40B, Member RAS Oncogene Family (RAB40B))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RAB40B Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-RAB40B Antikörper

Bindungsspezifität: Middle Region

Spezifität: RAB40 B antibody was raised against the middle region of RAB40

Aufreinigung: Affinity purified

Immunogen: RAB40 B antibody was raised using the middle region of RAB40 corresponding to a region with amino acids YAERLGVTFFEVSPLCNFNITESFTELARIVLLRHGMDRLWRPSKVLSLQ

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RAB40B Blocking Peptide, (ABIN936001), is also available for use as a blocking control in assays to test for specificity of this RAB40B antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAB40 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RAB40B

Target: RAB40B (RAB40B, Member RAS Oncogene Family (RAB40B))

Andere Bezeichnung: RAB40B

Hintergrund: RAB40B has similarity to a yeast protein which suggests a role of the gene product in regulating secretory vesicles.

Molekulargewicht: 31 kDa (MW of target protein)