RAB40A Antikörper (Middle Region)

Produktnummer ABIN634428

Produktdetails anti-RAB40A Antikörper

Target: RAB40A (RAB40A, Member RAS Oncogene Family (RAB40A))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RAB40A Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: RAB40 A antibody was raised against the middle region of RAB40

Aufreinigung: Affinity purified

Immunogen: RAB40 A antibody was raised using the middle region of RAB40 corresponding to a region with amino acids RPSKVLSLQDLCCRTIVSCTPVHLVDKLPLPSTLRSHLKSFSMAKGLNAR

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RAB40A Blocking Peptide, catalog no. 33R-8107, is also available for use as a blocking control in assays to test for specificity of this RAB40A antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAB40 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RAB40A

Target: RAB40A (RAB40A, Member RAS Oncogene Family (RAB40A))

Andere Bezeichnung: RAB40A (RAB40A Produkte)

Synonyme: RAR2 antikoerper, RAR2A antikoerper, RAB40A, member RAS oncogene family antikoerper, RAB40A antikoerper

Hintergrund: RAB40A belongs to the small GTPase superfamily, Rab family. It contains 1 SOCS box domain. RAB40A may be a substrate-recognition component of a SCF-like ECS (Elongin-Cullin-SOCS-box protein) E3 ubiquitin ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.

Molekulargewicht: 31 kDa (MW of target protein)