RASL10A Antikörper (N-Term)

Produktnummer ABIN634426

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch RASL10A in WB. Er zeigt eine Reaktivität gegenüber Human.

Kurzübersicht für RASL10A Antikörper (N-Term) (ABIN634426)

Target: RASL10A (RAS-Like, Family 10, Member A (RASL10A))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RASL10A Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-RASL10A Antikörper

Bindungsspezifität: N-Term

Spezifität: RASL10 A antibody was raised against the N terminal of RASL10

Aufreinigung: Affinity purified

Immunogen: RASL10 A antibody was raised using the N terminal of RASL10 corresponding to a region with amino acids PTDGPRLYRPAVLLDGAVYDLSIRDGDVAGPGSSPGGPEEWPDAKDWSLQ

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RASL10A Blocking Peptide, (ABIN5615769), is also available for use as a blocking control in assays to test for specificity of this RASL10A antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RASL10 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RASL10A

Target: RASL10A (RAS-Like, Family 10, Member A (RASL10A))

Andere Bezeichnung: RASL10A

Hintergrund: The specific function of RASL10A is not yet known.

Molekulargewicht: 22 kDa (MW of target protein)