Pkc beta 1 Antikörper (N-Term)

Produktnummer ABIN634421

Produktdetails anti-Pkc beta 1 Antikörper

Target: Pkc beta 1 (Protein Kinase C, beta 1 (Pkc beta 1))

Bindungsspezifität: N-Term

Reaktivität: Ratte, Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Pkc beta 1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: PRKCB1 antibody was raised against the N terminal of PRKCB1

Aufreinigung: Affinity purified

Immunogen: PRKCB1 antibody was raised using the N terminal of PRKCB1 corresponding to a region with amino acids MADPAAGPPPSEGEESTVRFARKGALRQKNVHEVKNHKFTARFFKQPTFC

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PRKCB1 Blocking Peptide, catalog no. 33R-5625, is also available for use as a blocking control in assays to test for specificity of this PRKCB1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRKCB1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Pkc beta 1

Target: Pkc beta 1 (Protein Kinase C, beta 1 (Pkc beta 1))

Andere Bezeichnung: PRKCB1 (Pkc beta 1 Produkte)

Synonyme: PKC-beta antikoerper, PKCB antikoerper, PRKCB1 antikoerper, PRKCB2 antikoerper, A130082F03Rik antikoerper, PKC-Beta antikoerper, Pkcb antikoerper, Prkcb1 antikoerper, Prkcb2 antikoerper, PKC antikoerper, PRKCB_tv2 antikoerper, protein kinase C beta antikoerper, protein kinase C, beta antikoerper, PRKCB antikoerper, Prkcb antikoerper

Hintergrund: Protein kinase C (PKC) is a family of serine- and threonine-specific protein kinases that can be activated by calcium and second messenger diacylglycerol. PKC family members phosphorylate a wide variety of protein targets.

Molekulargewicht: 77 kDa (MW of target protein)