Pkc beta 1 Antikörper (N-Term)

Produktnummer ABIN634421

Der Kaninchen Polyklonal Anti-Pkc beta 1-Antikörper wurde für WB validiert. Er ist geeignet, Pkc beta 1 in Proben von Ratte, Human und Maus zu detektieren.

Kurzübersicht für Pkc beta 1 Antikörper (N-Term) (ABIN634421)

Target: Pkc beta 1 (Protein Kinase C, beta 1 (Pkc beta 1))

Reaktivität: Ratte, Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Pkc beta 1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-Pkc beta 1 Antikörper

Bindungsspezifität: N-Term

Spezifität: PRKCB1 antibody was raised against the N terminal of PRKCB1

Aufreinigung: Affinity purified

Immunogen: PRKCB1 antibody was raised using the N terminal of PRKCB1 corresponding to a region with amino acids MADPAAGPPPSEGEESTVRFARKGALRQKNVHEVKNHKFTARFFKQPTFC

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PRKCB1 Blocking Peptide, (ABIN5615556), is also available for use as a blocking control in assays to test for specificity of this PRKCB1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRKCB1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Pkc beta 1

Target: Pkc beta 1 (Protein Kinase C, beta 1 (Pkc beta 1))

Andere Bezeichnung: PRKCB1

Hintergrund: Protein kinase C (PKC) is a family of serine- and threonine-specific protein kinases that can be activated by calcium and second messenger diacylglycerol. PKC family members phosphorylate a wide variety of protein targets.

Molekulargewicht: 77 kDa (MW of target protein)