Pleckstrin Antikörper (N-Term)

Produktnummer ABIN634412

Der Kaninchen Polyklonal Anti-Pleckstrin-Antikörper wurde für WB validiert. Er ist geeignet, Pleckstrin in Proben von Human, Maus und Ratte zu detektieren.

Kurzübersicht für Pleckstrin Antikörper (N-Term) (ABIN634412)

Target: Pleckstrin (PLEK)

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Pleckstrin Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-Pleckstrin Antikörper

Bindungsspezifität: N-Term

Spezifität: PLEK antibody was raised against the N terminal of PLEK

Aufreinigung: Affinity purified

Immunogen: PLEK antibody was raised using the N terminal of PLEK corresponding to a region with amino acids MEPKRIREGYLVKKGSVFNTWKPMWVVLLEDGIEFYKKKSDNSPKGMIPL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PLEK Blocking Peptide, (ABIN5615413), is also available for use as a blocking control in assays to test for specificity of this PLEK antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PLEK antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Pleckstrin

Target: Pleckstrin (PLEK)

Andere Bezeichnung: PLEK

Hintergrund: PLEK is a major protein kinase C substrate of platelets, its exact function is not known.

Molekulargewicht: 40 kDa (MW of target protein)

Pathways: Inositol Metabolic Process, Regulation of G-Protein Coupled Receptor Protein Signaling, Regulation of Cell Size, Regulation of Carbohydrate Metabolic Process