ASB8 Antikörper (N-Term)

Produktnummer ABIN634410

Dieses Anti-ASB8-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von ASB8 in WB. Geeignet für Human, Maus und Ratte.

Kurzübersicht für ASB8 Antikörper (N-Term) (ABIN634410)

Target: ASB8 (Ankyrin Repeat and SOCS Box Containing 8 (ASB8))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ASB8 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-ASB8 Antikörper

Bindungsspezifität: N-Term

Spezifität: ASB8 antibody was raised against the N terminal of ASB8

Aufreinigung: Affinity purified

Immunogen: ASB8 antibody was raised using the N terminal of ASB8 corresponding to a region with amino acids MSSSMWYIMQSIQSKYSLSERLIRTIAAIRSFPHDNVEDLIRGGADVNCT

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ASB8 Blocking Peptide, (ABIN5612182), is also available for use as a blocking control in assays to test for specificity of this ASB8 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ASB8 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ASB8

Target: ASB8 (Ankyrin Repeat and SOCS Box Containing 8 (ASB8))

Andere Bezeichnung: ASB8

Hintergrund: ASB8 may be a substrate-recognition component of a SCF-like ECS (Elongin-Cullin-SOCS-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.

Molekulargewicht: 32 kDa (MW of target protein)