DUSP10 Antikörper (N-Term)

Produktnummer ABIN634409

Der Kaninchen Polyklonal Anti-DUSP10-Antikörper wurde für WB validiert. Er ist geeignet, DUSP10 in Proben von Human, Maus und Ratte zu detektieren.

Kurzübersicht für DUSP10 Antikörper (N-Term) (ABIN634409)

Target: DUSP10 (Dual Specificity Phosphatase 10 (DUSP10))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DUSP10 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-DUSP10 Antikörper

Bindungsspezifität: N-Term

Spezifität: DUSP10 antibody was raised against the N terminal of DUSP10

Aufreinigung: Affinity purified

Immunogen: DUSP10 antibody was raised using the N terminal of DUSP10 corresponding to a region with amino acids MQRLNIGYVINVTTHLPLYHYEKGLFNYKRLPATDSNKQNLRQYFEEAFE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DUSP10 Blocking Peptide, (ABIN5613268), is also available for use as a blocking control in assays to test for specificity of this DUSP10 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DUSP10 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DUSP10

Target: DUSP10 (Dual Specificity Phosphatase 10 (DUSP10))

Andere Bezeichnung: DUSP10

Hintergrund: Dual specificity protein phosphatases inactivate their target kinases by dephosphorylating both the phosphoserine/threonine and phosphotyrosine residues.

Molekulargewicht: 16 kDa (MW of target protein)