RAB39B Antikörper (N-Term)

Produktnummer ABIN634406

Produktdetails anti-RAB39B Antikörper

Target: RAB39B (RAB39B, Member RAS Oncogene Family (RAB39B))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RAB39B Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: RAB39 B antibody was raised against the N terminal of RAB39

Aufreinigung: Affinity purified

Immunogen: RAB39 B antibody was raised using the N terminal of RAB39 corresponding to a region with amino acids MEAIWLYQFRLIVIGDSTVGKSCLIRRFTEGRFAQVSDPTVGVDFFSRLV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RAB39B Blocking Peptide, catalog no. 33R-5891, is also available for use as a blocking control in assays to test for specificity of this RAB39B antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAB30 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RAB39B

Target: RAB39B (RAB39B, Member RAS Oncogene Family (RAB39B))

Andere Bezeichnung: RAB39B (RAB39B Produkte)

Synonyme: RAB39B antikoerper, LOC100221662 antikoerper, zgc:153068 antikoerper, MRX72 antikoerper, 6330580M05Rik antikoerper, RAB39B, member RAS oncogene family antikoerper, RAB39B, member RAS oncogene family a antikoerper, RAB39B, member RAS oncogene family b antikoerper, RAB39B antikoerper, rab39ba antikoerper, rab39bb antikoerper, Rab39b antikoerper

Hintergrund: RAB39B may be involved in vesicular trafficking.

Molekulargewicht: 24 kDa (MW of target protein)