RAB39B Antikörper (N-Term)
-
- Target Alle RAB39B Antikörper anzeigen
- RAB39B (RAB39B, Member RAS Oncogene Family (RAB39B))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser RAB39B Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- RAB39 B antibody was raised against the N terminal of RAB39
- Aufreinigung
- Affinity purified
- Immunogen
- RAB39 B antibody was raised using the N terminal of RAB39 corresponding to a region with amino acids MEAIWLYQFRLIVIGDSTVGKSCLIRRFTEGRFAQVSDPTVGVDFFSRLV
- Top Product
- Discover our top product RAB39B Primärantikörper
-
anti-RAB39B, Member RAS Oncogene Family (RAB39B) (AA 1-213) antibody
RAB39B Reaktivität: Human ELISA, IHC, IF Wirt: Kaninchen Polyclonal unconjugated
anti-RAB39B, Member RAS Oncogene Family (RAB39B) (AA 1-213) antibodyRAB39B Reaktivität: Human ELISA, WB Wirt: Maus Monoclonal 1E11 unconjugated
anti-RAB39B, Member RAS Oncogene Family (RAB39B) antibodyRAB39B Reaktivität: Human, Maus ELISA, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-RAB39B, Member RAS Oncogene Family (RAB39B) (AA 1-213) antibodyRAB39B Reaktivität: Human WB, IP Wirt: Kaninchen Polyclonal unconjugated
anti-RAB39B, Member RAS Oncogene Family (RAB39B) (AA 12-40), (N-Term) antibodyRAB39B Reaktivität: Human, Maus WB Wirt: Kaninchen Polyclonal RB36942 unconjugated
anti-RAB39B, Member RAS Oncogene Family (RAB39B) (N-Term) antibodyRAB39B Reaktivität: Human, Maus, Rind (Kuh), Meerschweinchen, Pferd, Kaninchen, Zebrafisch (Danio rerio), Fledermaus, Hamster, Affe, Schwein WB Wirt: Kaninchen Polyclonal unconjugated
anti-RAB39B, Member RAS Oncogene Family (RAB39B) (N-Term) antibodyRAB39B Reaktivität: Human, Maus, Ratte, Rind (Kuh), Meerschweinchen, Pferd, Kaninchen, Zebrafisch (Danio rerio), Hund, Saccharomyces cerevisiae WB Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
RAB39B Blocking Peptide, catalog no. 33R-5891, is also available for use as a blocking control in assays to test for specificity of this RAB39B antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAB30 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RAB39B (RAB39B, Member RAS Oncogene Family (RAB39B))
- Andere Bezeichnung
- RAB39B (RAB39B Produkte)
- Hintergrund
- RAB39B may be involved in vesicular trafficking.
- Molekulargewicht
- 24 kDa (MW of target protein)
-
