RAB15 Antikörper (N-Term)

Produktnummer ABIN634404

Produktdetails anti-RAB15 Antikörper

Target: RAB15 (RAB15, Member RAS Onocogene Family (RAB15))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RAB15 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: RAB15 antibody was raised against the N terminal of RAB15

Aufreinigung: Affinity purified

Immunogen: RAB15 antibody was raised using the N terminal of RAB15 corresponding to a region with amino acids SSHISTIGVDFKMKTIEVDGIKVRIQIWDTAGQERYQTITKQYYRRAQGI

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RAB15 Blocking Peptide, catalog no. 33R-8810, is also available for use as a blocking control in assays to test for specificity of this RAB15 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAB15 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RAB15

Target: RAB15 (RAB15, Member RAS Onocogene Family (RAB15))

Andere Bezeichnung: RAB15 (RAB15 Produkte)

Synonyme: si:dkey-263p20.2 antikoerper, zgc:86635 antikoerper, 2310012G06Rik antikoerper, AI840042 antikoerper, RAB15, member RAS oncogene family antikoerper, RAB15, member RAS oncogene family S homeolog antikoerper, rab15 antikoerper, rab15.S antikoerper, RAB15 antikoerper, Rab15 antikoerper

Hintergrund: RAB15 may act in concert with RAB3A in regulating aspects of synaptic vesicle membrane flow within the nerve terminal.

Molekulargewicht: 23 kDa (MW of target protein)