RAB15 Antikörper (N-Term)
-
- Target Alle RAB15 Antikörper anzeigen
- RAB15 (RAB15, Member RAS Onocogene Family (RAB15))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser RAB15 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- RAB15 antibody was raised against the N terminal of RAB15
- Aufreinigung
- Affinity purified
- Immunogen
- RAB15 antibody was raised using the N terminal of RAB15 corresponding to a region with amino acids SSHISTIGVDFKMKTIEVDGIKVRIQIWDTAGQERYQTITKQYYRRAQGI
- Top Product
- Discover our top product RAB15 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
RAB15 Blocking Peptide, catalog no. 33R-8810, is also available for use as a blocking control in assays to test for specificity of this RAB15 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAB15 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RAB15 (RAB15, Member RAS Onocogene Family (RAB15))
- Andere Bezeichnung
- RAB15 (RAB15 Produkte)
- Synonyme
- si:dkey-263p20.2 antikoerper, zgc:86635 antikoerper, 2310012G06Rik antikoerper, AI840042 antikoerper, RAB15, member RAS oncogene family antikoerper, RAB15, member RAS oncogene family S homeolog antikoerper, rab15 antikoerper, rab15.S antikoerper, RAB15 antikoerper, Rab15 antikoerper
- Hintergrund
- RAB15 may act in concert with RAB3A in regulating aspects of synaptic vesicle membrane flow within the nerve terminal.
- Molekulargewicht
- 23 kDa (MW of target protein)
-