RASL12 Antikörper (N-Term)

Produktnummer ABIN634395

Produktdetails anti-RASL12 Antikörper

Target: RASL12 (RAS-Like, Family 12 (RASL12))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RASL12 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: RASL12 antibody was raised against the N terminal of RASL12

Aufreinigung: Affinity purified

Immunogen: RASL12 antibody was raised using the N terminal of RASL12 corresponding to a region with amino acids MSSVFGKPRAGSGPQSAPLEVNLAILGRRGAGKSALTVKFLTKRFISEYD

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RASL12 Blocking Peptide, catalog no. 33R-6517, is also available for use as a blocking control in assays to test for specificity of this RASL12 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RASL12 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RASL12

Target: RASL12 (RAS-Like, Family 12 (RASL12))

Andere Bezeichnung: RASL12 (RASL12 Produkte)

Synonyme: RIS antikoerper, 4631404I11Rik antikoerper, zgc:63633 antikoerper, RAS like family 12 antikoerper, RAS-like, family 12 antikoerper, RASL12 antikoerper, Rasl12 antikoerper, rasl12 antikoerper

Hintergrund: The function of RASL12 protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 30 kDa (MW of target protein)