RASL12 Antikörper (N-Term)

Produktnummer ABIN634395

Dieses Anti-RASL12-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von RASL12 in WB. Geeignet für Human, Maus und Ratte.

Kurzübersicht für RASL12 Antikörper (N-Term) (ABIN634395)

Target: RASL12 (RAS-Like, Family 12 (RASL12))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RASL12 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-RASL12 Antikörper

Bindungsspezifität: N-Term

Spezifität: RASL12 antibody was raised against the N terminal of RASL12

Aufreinigung: Affinity purified

Immunogen: RASL12 antibody was raised using the N terminal of RASL12 corresponding to a region with amino acids MSSVFGKPRAGSGPQSAPLEVNLAILGRRGAGKSALTVKFLTKRFISEYD

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RASL12 Blocking Peptide, (ABIN5615770), is also available for use as a blocking control in assays to test for specificity of this RASL12 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RASL12 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RASL12

Target: RASL12 (RAS-Like, Family 12 (RASL12))

Andere Bezeichnung: RASL12

Hintergrund: The function of RASL12 protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 30 kDa (MW of target protein)