IFIT5 Antikörper (N-Term)

Produktnummer ABIN634392

Produktdetails anti-IFIT5 Antikörper

Target: IFIT5 (Interferon-Induced Protein with Tetratricopeptide Repeats 5 (IFIT5))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser IFIT5 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: IFIT5 antibody was raised against the N terminal of IFIT5

Aufreinigung: Affinity purified

Immunogen: IFIT5 antibody was raised using the N terminal of IFIT5 corresponding to a region with amino acids LEEAQKYTGKIGNVCKKLSSPSNYKLECPETDCEKGWALLKFGGKYYQKA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

IFIT5 Blocking Peptide, catalog no. 33R-4886, is also available for use as a blocking control in assays to test for specificity of this IFIT5 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IFIT5 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu IFIT5

Target: IFIT5 (Interferon-Induced Protein with Tetratricopeptide Repeats 5 (IFIT5))

Andere Bezeichnung: IFIT5 (IFIT5 Produkte)

Synonyme: ri58 antikoerper, DKFZp469M2320 antikoerper, P58 antikoerper, RI58 antikoerper, interferon induced protein with tetratricopeptide repeats 5 antikoerper, interferon induced protein with tetratricopeptide repeats 5 L homeolog antikoerper, interferon-induced protein with tetratricopeptide repeats 5 antikoerper, IFIT5 antikoerper, ifit5.L antikoerper, LOC100024963 antikoerper, LOC100151816 antikoerper, ifit5 antikoerper

Hintergrund: IFIT5 belongs to the IFIT family. It contains 8 TPR repeats. The exact function of IFIT5 remains unknown.

Molekulargewicht: 56 kDa (MW of target protein)