RAB5 Antikörper (Middle Region)

Produktnummer ABIN634386

Produktdetails anti-RAB5 Antikörper

Target: RAB5 (RAB5A) (RAB5A, Member RAS Oncogene Family (RAB5A))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RAB5 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: RAB5 A antibody was raised against the middle region of RAB5

Aufreinigung: Affinity purified

Immunogen: RAB5 A antibody was raised using the middle region of RAB5 corresponding to a region with amino acids KTSMNVNEIFMAIAKKLPKNEPQNPGANSARGRGVDLTEPTQPTRNQCCS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RAB5A Blocking Peptide, catalog no. 33R-4691, is also available for use as a blocking control in assays to test for specificity of this RAB5A antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAB0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RAB5

Target: RAB5 (RAB5A) (RAB5A, Member RAS Oncogene Family (RAB5A))

Andere Bezeichnung: RAB5A (RAB5A Produkte)

Synonyme: RAB5 antikoerper, 2410015H04Rik antikoerper, AI663973 antikoerper, AU021172 antikoerper, nnyRab5a antikoerper, DDBDRAFT_0168594 antikoerper, DDBDRAFT_0229401 antikoerper, DDB_0168594 antikoerper, DDB_0229401 antikoerper, rab5 antikoerper, RAB5A antikoerper, Rab5a antikoerper, rab5al antikoerper, zgc:56644 antikoerper, fj38g08 antikoerper, hm:zehn1144 antikoerper, rab5a antikoerper, wu:fj38g08 antikoerper, RAB5A, member RAS oncogene family antikoerper, rab5A protein antikoerper, Rab5a, GTPase antikoerper, predicted protein antikoerper, Rab GTPase antikoerper, RAB5A, member RAS oncogene family L homeolog antikoerper, RAB5A, member RAS oncogene family, b antikoerper, RAB5A, member RAS oncogene family, a antikoerper, RAB5A antikoerper, Rab5a antikoerper, rab5A antikoerper, rab5a antikoerper, rab5a.L antikoerper, rab5ab antikoerper, rab5aa antikoerper

Hintergrund: RAB5A is required for the fusion of plasma membranes and early endosomes.

Molekulargewicht: 24 kDa (MW of target protein)

Pathways: Smooth Muscle Cell Migration, Regulation of long-term Neuronal Synaptic Plasticity