OTUD6B Antikörper (Middle Region)

Produktnummer ABIN634385

Der Kaninchen-Polyklonal Anti-OTUD6B-Antikörper wurde für WB validiert. Er ist geeignet zum Nachweis von OTUD6B in Proben aus Human, Maus und Ratte. }

Kurzübersicht für OTUD6B Antikörper (Middle Region) (ABIN634385)

Target: OTUD6B (OTU Domain Containing 6B (OTUD6B))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser OTUD6B Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-OTUD6B Antikörper

Bindungsspezifität: Middle Region

Spezifität: OTUD6 B antibody was raised against the middle region of OTUD6

Aufreinigung: Affinity purified

Immunogen: OTUD6 B antibody was raised using the middle region of OTUD6 corresponding to a region with amino acids EIIQADSPPIIVGEEYSKKPLILVYMRHAYGLGEHYNSVTRLVNIVTENC

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

OTUD6B Blocking Peptide, (ABIN937859), is also available for use as a blocking control in assays to test for specificity of this OTUD6B antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OTUD0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu OTUD6B

Target: OTUD6B (OTU Domain Containing 6B (OTUD6B))

Andere Bezeichnung: OTUD6B

Hintergrund: Deubiquitinating enzymes are proteases that specifically cleave ubiquitin linkages, negating the action of ubiquitin ligases. DUBA5 belongs to a DUB subfamily characterized by an ovarian tumor (OTU) domain.

Molekulargewicht: 37 kDa (MW of target protein)