RASGRP2 Antikörper
-
- Target Alle RASGRP2 Antikörper anzeigen
- RASGRP2 (RAS Guanyl Releasing Protein 2 (Calcium and DAG-Regulated) (RASGRP2))
-
Reaktivität
- Human, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser RASGRP2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- RASGRP2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LVRMFLMMHPWYIPSSQLAAKLLHIYQQSRKDNSNSLQVKTCHLVRYWIS
- Top Product
- Discover our top product RASGRP2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
RASGRP2 Blocking Peptide, catalog no. 33R-5537, is also available for use as a blocking control in assays to test for specificity of this RASGRP2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RASGRP2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RASGRP2 (RAS Guanyl Releasing Protein 2 (Calcium and DAG-Regulated) (RASGRP2))
- Andere Bezeichnung
- RASGRP2 (RASGRP2 Produkte)
- Synonyme
- CALDAG-GEFI antikoerper, CDC25L antikoerper, xrasgrp2 antikoerper, RASGRP2 antikoerper, Caldaggef1 antikoerper, CalDAG-GEFI antikoerper, rasgrp2 antikoerper, RAS guanyl releasing protein 2 antikoerper, RAS guanyl releasing protein 2 (calcium and DAG-regulated) S homeolog antikoerper, RAS, guanyl releasing protein 2 antikoerper, RAS guanyl releasing protein 2 (calcium and DAG-regulated) L homeolog antikoerper, RASGRP2 antikoerper, rasgrp2.S antikoerper, Rasgrp2 antikoerper, rasgrp2.L antikoerper
- Hintergrund
- The protein encoded by this gene is a brain-enriched nucleotide exchanged factor that contains an N-terminal GEF domain, 2 tandem repeats of EF-hand calcium-binding motifs, and a C-terminal diacylglycerol/phorbol ester-binding domain.
- Molekulargewicht
- 69 kDa (MW of target protein)
- Pathways
- T-Zell Rezeptor Signalweg
-