RRAD Antikörper (Middle Region)

Produktnummer ABIN634370

Produktdetails anti-RRAD Antikörper

Target: RRAD (Ras-Related Associated with Diabetes (RRAD))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RRAD Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: RRAD antibody was raised against the middle region of RRAD

Aufreinigung: Affinity purified

Immunogen: RRAD antibody was raised using the middle region of RRAD corresponding to a region with amino acids LARIFGGVEDGPEAEAAGHTYDRSIVVDGEEASLMVYDIWEQDGGRWLPG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RRAD Blocking Peptide, catalog no. 33R-4793, is also available for use as a blocking control in assays to test for specificity of this RRAD antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RRAD antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RRAD

Target: RRAD (Ras-Related Associated with Diabetes (RRAD))

Andere Bezeichnung: RRAD (RRAD Produkte)

Synonyme: ZGC:63471 antikoerper, RRAD antikoerper, RAD antikoerper, RAD1 antikoerper, REM3 antikoerper, Rad antikoerper, RRAD, Ras related glycolysis inhibitor and calcium channel regulator antikoerper, Ras-related associated with diabetes antikoerper, RRAD antikoerper, Rrad antikoerper

Hintergrund: RRAD may play an important role in cardiac antiarrhythmia via the strong suppression of voltage-gated L-type Ca2+ currents.

Molekulargewicht: 33 kDa (MW of target protein)