RRAD Antikörper (Middle Region)

Produktnummer ABIN634370

Der Kaninchen Polyklonal Anti-RRAD-Antikörper wurde für WB validiert. Er ist geeignet, RRAD in Proben von Human, Maus und Ratte zu detektieren.

Kurzübersicht für RRAD Antikörper (Middle Region) (ABIN634370)

Target: RRAD (Ras-Related Associated with Diabetes (RRAD))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RRAD Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-RRAD Antikörper

Bindungsspezifität: Middle Region

Spezifität: RRAD antibody was raised against the middle region of RRAD

Aufreinigung: Affinity purified

Immunogen: RRAD antibody was raised using the middle region of RRAD corresponding to a region with amino acids LARIFGGVEDGPEAEAAGHTYDRSIVVDGEEASLMVYDIWEQDGGRWLPG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RRAD Blocking Peptide, (ABIN940179), is also available for use as a blocking control in assays to test for specificity of this RRAD antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RRAD antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RRAD

Target: RRAD (Ras-Related Associated with Diabetes (RRAD))

Andere Bezeichnung: RRAD

Hintergrund: RRAD may play an important role in cardiac antiarrhythmia via the strong suppression of voltage-gated L-type Ca2+ currents.

Molekulargewicht: 33 kDa (MW of target protein)