RAB18 Antikörper (C-Term)

Produktnummer ABIN634369

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch RAB18 in WB. Er zeigt eine Reaktivität gegenüber Human und Maus.

Kurzübersicht für RAB18 Antikörper (C-Term) (ABIN634369)

Target: RAB18 (RAB18, Member RAS Oncogene Family (RAB18))

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RAB18 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-RAB18 Antikörper

Bindungsspezifität: C-Term

Spezifität: RAB18 antibody was raised against the C terminal of RAB18

Aufreinigung: Affinity purified

Immunogen: RAB18 antibody was raised using the C terminal of RAB18 corresponding to a region with amino acids LFIEASAKTCDGVQCAFEELVEKIIQTPGLWESENQNKGVKLSHREEGQG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RAB18 Blocking Peptide, (ABIN940325), is also available for use as a blocking control in assays to test for specificity of this RAB18 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAB18 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RAB18

Target: RAB18 (RAB18, Member RAS Oncogene Family (RAB18))

Andere Bezeichnung: RAB18

Hintergrund: RAB18 belongs to the small GTPase superfamily.

Molekulargewicht: 23 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interaktom