RAB23 Antikörper (N-Term)

Produktnummer ABIN634360

Produktdetails anti-RAB23 Antikörper

Target: RAB23 (RAB23, Member RAS Oncogene Family (RAB23))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RAB23 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: RAB23 antibody was raised against the N terminal of RAB23

Aufreinigung: Affinity purified

Immunogen: RAB23 antibody was raised using the N terminal of RAB23 corresponding to a region with amino acids TKDYKKTIGVDFLERQIQVNDEDVRLMLWDTAGQEEFDAITKAYYRGAQA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RAB23 Blocking Peptide, catalog no. 33R-9136, is also available for use as a blocking control in assays to test for specificity of this RAB23 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAB23 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RAB23

Target: RAB23 (RAB23, Member RAS Oncogene Family (RAB23))

Andere Bezeichnung: RAB23 (RAB23 Produkte)

Hintergrund: The protein encoded by this gene belongs to the small GTPase superfamily, Rab family. It may be involved in small GTPase mediated signal transduction and intracellular protein transportation.

Molekulargewicht: 27 kDa (MW of target protein)

Pathways: Tube Formation