MAP4K4 Antikörper (N-Term)

Produktnummer ABIN634358

Der Kaninchen Polyklonal Anti-MAP4K4-Antikörper wurde für WB validiert. Er ist geeignet, MAP4K4 in Proben von Human, Maus und Ratte zu detektieren.

Kurzübersicht für MAP4K4 Antikörper (N-Term) (ABIN634358)

Target: MAP4K4 (Mitogen-Activated Protein Kinase Kinase Kinase Kinase 4 (MAP4K4))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MAP4K4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-MAP4K4 Antikörper

Bindungsspezifität: N-Term

Spezifität: MAP4 K4 antibody was raised against the N terminal of MAP4 4

Aufreinigung: Affinity purified

Immunogen: MAP4 K4 antibody was raised using the N terminal of MAP4 4 corresponding to a region with amino acids PFIRDQPNERQVRIQLKDHIDRTRKKRGEKDETEYEYSGSEEEEEEVPEQ

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MAP4K4 Blocking Peptide, (ABIN5614656), is also available for use as a blocking control in assays to test for specificity of this MAP4K4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAP0 4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MAP4K4

Target: MAP4K4 (Mitogen-Activated Protein Kinase Kinase Kinase Kinase 4 (MAP4K4))

Andere Bezeichnung: MAP4K4

Hintergrund: MAP4K4 is the serine/threonine kinase that may play a role in the response to environmental stress and cytokines such as TNF-alpha. MAP4K4 appears to act upstream of the JUN N-terminal pathway.

Molekulargewicht: 133 kDa (MW of target protein)