MAP4K2 Antikörper (N-Term)

Produktnummer ABIN634356

Produktdetails anti-MAP4K2 Antikörper

Target: MAP4K2 (Mitogen-Activated Protein Kinase Kinase Kinase Kinase 2 (MAP4K2))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MAP4K2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: MAP4 K2 antibody was raised against the N terminal of MAP4 2

Aufreinigung: Affinity purified

Immunogen: MAP4 K2 antibody was raised using the N terminal of MAP4 2 corresponding to a region with amino acids TVTSELAAVKIVKLDPGDDISSLQQEITILRECRHPNVVAYIGSYLRNDR

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MAP4K2 Blocking Peptide, catalog no. 33R-9374, is also available for use as a blocking control in assays to test for specificity of this MAP4K2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAP0 2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MAP4K2

Target: MAP4K2 (Mitogen-Activated Protein Kinase Kinase Kinase Kinase 2 (MAP4K2))

Andere Bezeichnung: MAP4K2 (MAP4K2 Produkte)

Synonyme: BL44 antikoerper, GCK antikoerper, RAB8IP antikoerper, AI385662 antikoerper, Rab8ip antikoerper, MAP4K2 antikoerper, dZ150L22.2 antikoerper, map4k2l antikoerper, map4k2l-2 antikoerper, map4k3l antikoerper, si:dz150l22.2 antikoerper, si:dz263j20.1 antikoerper, zgc:136670 antikoerper, mitogen-activated protein kinase kinase kinase kinase 2 antikoerper, mitogen activated protein kinase kinase kinase kinase 2 antikoerper, MAP4K2 antikoerper, Map4k2 antikoerper, LOC103346779 antikoerper, map4k2 antikoerper

Hintergrund: MAP4K2 is a member of the serine/threonine protein kinase family. Although this kinase is found in many tissues, its expression in lymphoid follicles is restricted to the cells of germinal centre, where it may participate in B-cell differentiation. This kinase can be activated by TNF-alpha, and has been shown to specifically activate MAP kinases. This kinase is also found to interact with TNF receptor-associated factor 2 (TRAF2), which is involved in the activation of MAP3K1/MEKK1.

Molekulargewicht: 91 kDa (MW of target protein)