NEK6 Antikörper

Produktnummer ABIN634350

Dieses Anti-NEK6-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von NEK6 in WB. Geeignet für Human, Maus und Ratte.

Kurzübersicht für NEK6 Antikörper (ABIN634350)

Target: NEK6 (NIMA (Never in Mitosis Gene A)-Related Kinase 6 (NEK6))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser NEK6 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-NEK6 Antikörper

Aufreinigung: Affinity purified

Immunogen: NEK6 antibody was raised using a synthetic peptide corresponding to a region with amino acids FRCSLADFQIEKKIGRGQFSEVYKATCLLDRKTVALKKVQIFEMMDAKAR

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

NEK6 Blocking Peptide, (ABIN938427), is also available for use as a blocking control in assays to test for specificity of this NEK6 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NEK6 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu NEK6

Target: NEK6 (NIMA (Never in Mitosis Gene A)-Related Kinase 6 (NEK6))

Andere Bezeichnung: NEK6

Hintergrund: The Aspergillus nidulans 'never in mitosis A' (NIMA) gene encodes a serine/threonine kinase that controls initiation of mitosis. NIMA-related kinases (NEKs) are a group of protein kinases that are homologous to NIMA. Evidence suggests that NEKs perform functions similar to those of NIMA.

Molekulargewicht: 36 kDa (MW of target protein)