FES Antikörper (N-Term)

Produktnummer ABIN634347

Produktdetails anti-FES Antikörper

Target: FES (Feline Sarcoma Oncogene (FES))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FES Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: FES antibody was raised against the N terminal of FES

Aufreinigung: Affinity purified

Immunogen: FES antibody was raised using the N terminal of FES corresponding to a region with amino acids ARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FES Blocking Peptide, catalog no. 33R-1466, is also available for use as a blocking control in assays to test for specificity of this FES antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FES antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu FES

Target: FES (Feline Sarcoma Oncogene (FES))

Andere Bezeichnung: FES (FES Produkte)

Synonyme: FPS antikoerper, RGD1564385 antikoerper, AI586313 antikoerper, BB137047 antikoerper, c-fes antikoerper, FES antikoerper, c-fps antikoerper, FES proto-oncogene, tyrosine kinase antikoerper, feline sarcoma oncogene antikoerper, FES antikoerper, Fes antikoerper, fes antikoerper

Hintergrund: FES is the human cellular counterpart of a feline sarcoma retrovirus protein with transforming capabilities. FES has tyrosine-specific protein kinase activity and that activity is required for maintenance of cellular transformation. Its chromosomal location has linked it to a specific translocation event identified in patients with acute promyelocytic leukemia but it is also involved in normal hematopoiesis.

Molekulargewicht: 93 kDa (MW of target protein)

Pathways: Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process, Signaling Events mediated by VEGFR1 and VEGFR2