SH2D3C Antikörper (N-Term)

Produktnummer ABIN634344

Produktdetails anti-SH2D3C Antikörper

Target: SH2D3C (SH2 Domain Containing 3C (SH2D3C))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SH2D3C Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: SH2 D2 antibody was raised against the N terminal of SH2 2

Aufreinigung: Affinity purified

Immunogen: SH2 D2 antibody was raised using the N terminal of SH2 2 corresponding to a region with amino acids AGSDYVKFSKEKYILDSSPEKLHKELEEELKLSSTDLRSHAWYHGRIPRE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SH2D3C Blocking Peptide, catalog no. 33R-1220, is also available for use as a blocking control in assays to test for specificity of this SH2D3C antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SH0 0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SH2D3C

Target: SH2D3C (SH2 Domain Containing 3C (SH2D3C))

Andere Bezeichnung: SH2D3C (SH2D3C Produkte)

Synonyme: sh2d3c antikoerper, zgc:56490 antikoerper, SH2D3C antikoerper, CHAT antikoerper, NSP3 antikoerper, PRO34088 antikoerper, SHEP1 antikoerper, Chat antikoerper, Nsp3 antikoerper, Shep1 antikoerper, SH2 domain containing 3Cb antikoerper, SH2 domain containing 3C antikoerper, SH2 domain-containing protein 3C antikoerper, SH2 domain containing 3C L homeolog antikoerper, sh2d3cb antikoerper, SH2D3C antikoerper, LOC100466471 antikoerper, sh2d3c antikoerper, sh2d3c.L antikoerper, Sh2d3c antikoerper

Hintergrund: SH2D3C is an Eph receptor-binding protein which may be a positive regulator of TCR signaling. Binding to BCAR1 of SH2D3C is required to induce membrane ruffling and promote EGF-dependent cell migration.

Molekulargewicht: 77 kDa (MW of target protein)