STK38 Antikörper (C-Term)
-
- Target Alle STK38 Antikörper anzeigen
- STK38 (serine/threonine Kinase 38 (STK38))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser STK38 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- STK38 antibody was raised against the C terminal of STK38
- Aufreinigung
- Affinity purified
- Immunogen
- STK38 antibody was raised using the C terminal of STK38 corresponding to a region with amino acids IGAPGVEEIKSNSFFEGVDWEHIRERPAAISIEIKSIDDTSNFDEFPESD
- Top Product
- Discover our top product STK38 Primärantikörper
-
anti-serine/threonine Kinase 38 (STK38) (AA 365-465) antibody
STK38 Reaktivität: Human WB, ELISA, IF, IHC (p) Wirt: Maus Monoclonal 2F6 unconjugated
anti-serine/threonine Kinase 38 (STK38) (AA 1-465) antibodySTK38 Reaktivität: Human WB, ELISA, IF, IHC (p), IP Wirt: Maus Monoclonal 2G8-1F3 unconjugated
anti-serine/threonine Kinase 38 (STK38) (AA 365-465) antibodySTK38 Reaktivität: Human WB, ELISA, RNAi Wirt: Maus Monoclonal 2F3 unconjugated
anti-serine/threonine Kinase 38 (STK38) (AA 365-465) antibodySTK38 Reaktivität: Human WB, ELISA, IHC (p) Wirt: Maus Monoclonal 6F1 unconjugated
anti-serine/threonine Kinase 38 (STK38) (AA 365-466) antibodySTK38 Reaktivität: Human, Maus, Ratte WB, IHC (p), EIA Wirt: Maus Monoclonal 6F1 unconjugated
anti-serine/threonine Kinase 38 (STK38) (AA 1-465) antibodySTK38 Reaktivität: Human WB Wirt: Kaninchen Polyclonal unconjugated
anti-serine/threonine Kinase 38 (STK38) (AA 1-200) antibodySTK38 Reaktivität: Human WB, IF Wirt: Kaninchen Polyclonal unconjugated
anti-serine/threonine Kinase 38 (STK38) (C-Term) antibodySTK38 Reaktivität: Human WB, ELISA Wirt: Kaninchen Polyclonal unconjugated
anti-serine/threonine Kinase 38 (STK38) (AA 365-466) antibodySTK38 Reaktivität: Human, Maus, Ratte WB, ELISA, IHC, IHC (p) Wirt: Maus Monoclonal 6F1 unconjugated
anti-serine/threonine Kinase 38 (STK38) (AA 1-200) antibodySTK38 Reaktivität: Human ELISA, IHC Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
STK38 Blocking Peptide, catalog no. 33R-3966, is also available for use as a blocking control in assays to test for specificity of this STK38 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of STK38 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- STK38 (serine/threonine Kinase 38 (STK38))
- Andere Bezeichnung
- STK38 (STK38 Produkte)
- Synonyme
- NDR antikoerper, NDR1 antikoerper, 5830476G13Rik antikoerper, 9530097A09Rik antikoerper, AA617404 antikoerper, Ndr1 antikoerper, trc antikoerper, si:ch1073-272h17.2 antikoerper, wu:fj80h03 antikoerper, zgc:55572 antikoerper, serine/threonine kinase 38 antikoerper, serine/threonine kinase 38 S homeolog antikoerper, serine/threonine kinase 38b antikoerper, serine/threonine kinase 38a antikoerper, STK38 antikoerper, Stk38 antikoerper, stk38.S antikoerper, stk38b antikoerper, stk38a antikoerper
- Hintergrund
- STK38 belongs to the protein kinase superfamily, AGC Ser/Thr protein kinase family. It contains 1 AGC-kinase C-terminal domain and 1 protein kinase domain. NDR-driven centrosome duplication requires Cdk2 activity and that Cdk2-induced centrosome amplification is affected upon reduction of NDR activity.
- Molekulargewicht
- 54 kDa (MW of target protein)
-
