STK38 Antikörper (C-Term)

Produktnummer ABIN634342

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch STK38 in WB. Er zeigt eine Reaktivität gegenüber Human, Maus und Ratte.

Kurzübersicht für STK38 Antikörper (C-Term) (ABIN634342)

Target: STK38 (serine/threonine Kinase 38 (STK38))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser STK38 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-STK38 Antikörper

Bindungsspezifität: C-Term

Spezifität: STK38 antibody was raised against the C terminal of STK38

Aufreinigung: Affinity purified

Immunogen: STK38 antibody was raised using the C terminal of STK38 corresponding to a region with amino acids IGAPGVEEIKSNSFFEGVDWEHIRERPAAISIEIKSIDDTSNFDEFPESD

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

STK38 Blocking Peptide, (ABIN939352), is also available for use as a blocking control in assays to test for specificity of this STK38 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of STK38 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu STK38

Target: STK38 (serine/threonine Kinase 38 (STK38))

Andere Bezeichnung: STK38

Hintergrund: STK38 belongs to the protein kinase superfamily, AGC Ser/Thr protein kinase family. It contains 1 AGC-kinase C-terminal domain and 1 protein kinase domain. NDR-driven centrosome duplication requires Cdk2 activity and that Cdk2-induced centrosome amplification is affected upon reduction of NDR activity.

Molekulargewicht: 54 kDa (MW of target protein)