SNX18 Antikörper (N-Term)

Produktnummer ABIN634337

Der Kaninchen Polyklonal Anti-SNX18-Antikörper wurde für WB validiert. Er ist geeignet, SNX18 in Proben von Human zu detektieren.

Kurzübersicht für SNX18 Antikörper (N-Term) (ABIN634337)

Target: SNX18 (Sorting Nexin 18 (SNX18))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SNX18 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-SNX18 Antikörper

Bindungsspezifität: N-Term

Spezifität: SNAG1 antibody was raised against the N terminal Of Snag1

Aufreinigung: Affinity purified

Immunogen: SNAG1 antibody was raised using the N terminal Of Snag1 corresponding to a region with amino acids LLQPQQAPPPSTFQPPGAGFPYGGGALQPSPQQLYGGYQASQGSDDDWDD

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SNAG1 Blocking Peptide, (ABIN5616312), is also available for use as a blocking control in assays to test for specificity of this SNAG1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SNAG1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SNX18

Target: SNX18 (Sorting Nexin 18 (SNX18))

Andere Bezeichnung: SNAG1

Hintergrund: This gene encodes a member of the sorting nexin family. Members of this family contain a phox (PX) domain, which is a phosphoinositide binding domain, and are involved in intracellular trafficking.

Molekulargewicht: 69 kDa (MW of target protein)