SKAP1 Antikörper (N-Term)

Produktnummer ABIN634334

Produktdetails anti-SKAP1 Antikörper

Target: SKAP1 (Src Kinase Associated phosphoprotein 1 (SKAP1))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SKAP1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: SKAP1 antibody was raised against the N terminal of SKAP1

Aufreinigung: Affinity purified

Immunogen: SKAP1 antibody was raised using the N terminal of SKAP1 corresponding to a region with amino acids RDHILRGFQQIKARYYWDFQPQGGDIGQDSSDDNHSGTLGLSLTSDAPFL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SKAP1 Blocking Peptide, catalog no. 33R-7848, is also available for use as a blocking control in assays to test for specificity of this SKAP1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SKAP1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SKAP1

Target: SKAP1 (Src Kinase Associated phosphoprotein 1 (SKAP1))

Andere Bezeichnung: SKAP1 (SKAP1 Produkte)

Synonyme: 1700091G21Rik antikoerper, Scap1 antikoerper, Skap-55 antikoerper, SCAP1 antikoerper, SKAP55 antikoerper, Skap55 antikoerper, src family associated phosphoprotein 1 antikoerper, src kinase associated phosphoprotein 1 antikoerper, Skap1 antikoerper, SKAP1 antikoerper

Hintergrund: SKAP1 Is a T cell adaptor protein, a class of intracellular molecules with modular domains capable of recruiting additional proteins but that exhibit no intrinsic enzymatic activity. The encoded protein contains a unique N-terminal region followed by a PH domain and C-terminal SH3 domain. Along with the adhesion and degranulation-promoting adaptor protein, the encoded protein plays a critical role in inside-out signaling by coupling T-cell antigen receptor stimulation to the activation of integrins.

Molekulargewicht: 41 kDa (MW of target protein)