RHOU Antikörper (C-Term)

Produktnummer ABIN634330

Produktdetails anti-RHOU Antikörper

Target: RHOU (Ras Homolog Gene Family, Member U (RHOU))

Bindungsspezifität: C-Term

Reaktivität: Human, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RHOU Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: RHOU antibody was raised against the C terminal of RHOU

Aufreinigung: Affinity purified

Immunogen: RHOU antibody was raised using the C terminal of RHOU corresponding to a region with amino acids LKEVFDAAIVAGIQYSDTQQQPKKSKSRTPDKMKNLSKSWWKKYCCFV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RHOU Blocking Peptide, catalog no. 33R-5086, is also available for use as a blocking control in assays to test for specificity of this RHOU antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RHOU antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RHOU

Target: RHOU (Ras Homolog Gene Family, Member U (RHOU))

Andere Bezeichnung: RHOU (RHOU Produkte)

Synonyme: ARHU antikoerper, CDC42L1 antikoerper, DJ646B12.2 antikoerper, WRCH1 antikoerper, fJ646B12.2 antikoerper, hG28K antikoerper, 2310026M05Rik antikoerper, AI182090 antikoerper, Arhu antikoerper, G28K antikoerper, WRCH-1 antikoerper, mG28K antikoerper, arhu antikoerper, hg28k antikoerper, wrch1 antikoerper, wrch-1 antikoerper, cdc42l1 antikoerper, MGC107947 antikoerper, fj646b12.2 antikoerper, zgc:101642 antikoerper, wu:fb18g01 antikoerper, zgc:110357 antikoerper, Wrch antikoerper, rac-2 antikoerper, rhou antikoerper, xg28k antikoerper, ras homolog family member U antikoerper, ras homolog gene family, member U antikoerper, ras homolog family member Ua antikoerper, ras homolog family member Ub antikoerper, ras homolog family member U L homeolog antikoerper, RHOU antikoerper, Rhou antikoerper, rhou antikoerper, rhoua antikoerper, rhoub antikoerper, rhou.L antikoerper

Hintergrund: RHOU is a member of the Rho family of GTPases. It can activate PAK1 and JNK1, and can induce filopodium formation and stress fiber dissolution. It may also mediate the effects of WNT1 signaling in the regulation of cell morphology, cytoskeletal organization, and cell proliferation.

Molekulargewicht: 28 kDa (MW of target protein)