RHOU Antikörper (C-Term)
Kurzübersicht für RHOU Antikörper (C-Term) (ABIN634330)
Target
Alle RHOU Antikörper anzeigenReaktivität
Wirt
Klonalität
Konjugat
Applikation
-
-
Bindungsspezifität
- C-Term
-
Spezifität
- RHOU antibody was raised against the C terminal of RHOU
-
Aufreinigung
- Affinity purified
-
Immunogen
- RHOU antibody was raised using the C terminal of RHOU corresponding to a region with amino acids LKEVFDAAIVAGIQYSDTQQQPKKSKSRTPDKMKNLSKSWWKKYCCFV
-
-
-
-
Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. -
Kommentare
-
RHOU Blocking Peptide, (ABIN940472), is also available for use as a blocking control in assays to test for specificity of this RHOU antibody
-
Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
-
-
Format
- Lyophilized
-
Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RHOU antibody in PBS
-
Konzentration
- Lot specific
-
Buffer
- PBS
-
Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. -
Lagerung
- 4 °C/-20 °C
-
Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
-
- RHOU (Ras Homolog Gene Family, Member U (RHOU))
-
Andere Bezeichnung
- RHOU
-
Hintergrund
- RHOU is a member of the Rho family of GTPases. It can activate PAK1 and JNK1, and can induce filopodium formation and stress fiber dissolution. It may also mediate the effects of WNT1 signaling in the regulation of cell morphology, cytoskeletal organization, and cell proliferation.
-
Molekulargewicht
- 28 kDa (MW of target protein)
Target
-